PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00085759001
Common NameGSBRNA2T00085759001, LOC106360486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 201aa    MW: 21988.4 Da    PI: 9.3696
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00085759001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.6e-393190261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         ++++l+cprC s ntkfCyynny+lsqPr+fCk+CrryWtkGG+lrn+PvGgg+rkn ++
  GSBRNA2T00085759001 31 EQEQLNCPRCASPNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGSLRNIPVGGGTRKNSSK 90
                         57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-323389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8263589IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-243786IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MQEDLTSAAA YYHHQSMIMT AKQQQQPELP EQEQLNCPRC ASPNTKFCYY NNYNLSQPRH  60
FCKNCRRYWT KGGSLRNIPV GGGTRKNSSK RSSVGSSSSA PSSSSPKSKT VAVSDQESRT  120
TGNSGQEMDP TRMLYGLPVG DPSGGRFSSL LVSNMQQIRG VNYETGSGWY PGMELGLGSG  180
IRRNDDAALT DLAMNRVEKN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.40900.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00085759001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655545.11e-149PREDICTED: dof zinc finger protein DOF1.7-like
SwissprotO821554e-92DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A078IB661e-149A0A078IB66_BRANA; BnaA08g01830D protein
STRINGBra014297.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-77DOF zinc finger protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]